R31811

antibody from NSJ Bioreagents

Targeting: CLOCK bHLHe8, KAT13D, KIAA0334

Western blot (Supportive data in Antibodypedia)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

R31811

Provider

NSJ Bioreagents

Product name

CLOCK Antibody

Antibody type

Polyclonal

Antigen

Amino acids QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE of human CLOCK were used as the immunogen for the CLOCK antibody.

Description

Antigen affinity

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Vial size

100 µg

Concentration

Lyophilized; resuspend with 200 ul for 0.5 mg/ml

Storage

After reconstitution, the CLOCK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Western blot

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

Western blot of 1) rat skeletal muscle, 2) mouse skeletal muscle, 3) mouse NIH3T3, 4) human A549 and 5) human MCF7 lysate with CLOCK antibody. Predicted molecular weight ~95 kDa but routinely observed at 95-110 kDa.

Immunocytochemistry

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

ICC testing of FFPE human A549 cells with CLOCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

ICC testing of FFPE human SW480 cells with CLOCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

ICC testing of FFPE human PC-3 cells with CLOCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Immunohistochemistry

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE human intestinal cancer with CLOCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE mouse skeletal muscle with CLOCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE rat testis with CLOCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE human placenta with CLOCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.