ABIN486985

antibody from antibodies-online

Targeting: LBX1 HPX6, LBX1H

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

ABIN486985

Provider

antibodies-online

Product name

anti-Ladybird Homeobox 1 (LBX1) (Middle Region) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-LBX1 antibody: synthetic peptide directed towards the middle region of human LBX1

Description

Affinity Purified

Reactivity

Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish

Host

Rabbit

Antigen sequence

LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQ
AAEGR DGMTIFGQRQ


Epitope

Middle Region

Vial size

50 μg

Concentration

1mg/mL

Storage

-20°C

Handling

Avoid repeated freeze-thaw cycles.

References

Submitted references

The DNA sequence and comparative analysis of human chromosome 10.

Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J
Nature 2004 May 27;429(6990):375-81

Western blot

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Host: Rabbit Target Name: LBX1 Sample Tissue: NCI-H226 Antibody Dilution: 1.0 μg/mL LBX1 is supported by BioGPS gene expression data to be expressed in NCIH226