Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006662-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006662-M02, RRID:AB_875842
- Product name
- SOX9 monoclonal antibody (M02), clone 3C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SOX9.
- Antigen sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPP
ITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYM
NPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYT
QLTRP- Isotype
- IgG
- Antibody clone number
- 3C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references In vitro osteogenic potential of human mesenchymal stem cells is predicted by Runx2/Sox9 ratio.
Expression of cancer stem cell markers is more frequent in anaplastic thyroid carcinoma compared to papillary thyroid carcinoma and is related to adverse clinical outcome.
Supra- and infratentorial pediatric ependymomas differ significantly in NeuN, p75 and GFAP expression.
A molecular profile of focal segmental glomerulosclerosis from formalin-fixed, paraffin-embedded tissue.
Loebel C, Czekanska EM, Bruderer M, Salzmann G, Alini M, Stoddart MJ
Tissue engineering. Part A 2015 Jan;21(1-2):115-23
Tissue engineering. Part A 2015 Jan;21(1-2):115-23
Expression of cancer stem cell markers is more frequent in anaplastic thyroid carcinoma compared to papillary thyroid carcinoma and is related to adverse clinical outcome.
Yun JY, Kim YA, Choe JY, Min H, Lee KS, Jung Y, Oh S, Kim JE
Journal of clinical pathology 2014 Feb;67(2):125-33
Journal of clinical pathology 2014 Feb;67(2):125-33
Supra- and infratentorial pediatric ependymomas differ significantly in NeuN, p75 and GFAP expression.
Hagel C, Treszl A, Fehlert J, Harder J, von Haxthausen F, Kern M, von Bueren AO, Kordes U
Journal of neuro-oncology 2013 Apr;112(2):191-7
Journal of neuro-oncology 2013 Apr;112(2):191-7
A molecular profile of focal segmental glomerulosclerosis from formalin-fixed, paraffin-embedded tissue.
Hodgin JB, Borczuk AC, Nasr SH, Markowitz GS, Nair V, Martini S, Eichinger F, Vining C, Berthier CC, Kretzler M, D'Agati VD
The American journal of pathology 2010 Oct;177(4):1674-86
The American journal of pathology 2010 Oct;177(4):1674-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SOX9 monoclonal antibody (M02), clone 3C10 Western Blot analysis of SOX9 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02), clone 3C10.Lane 1: SOX9 transfected lysate(56.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SOX9 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SOX9 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol