HPA029200

GZMH antibody from Atlas Antibodies
CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029200
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029200, RRID:AB_10602908
Product name
Anti-GZMH
Provider product page
Atlas Antibodies - HPA029200
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPS
SKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTV
QKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGD
SGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFL
PWIKRTM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -