AV42686

GZMH antibody from Sigma-Aldrich
CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV42686
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV42686, RRID:AB_1849964
Product name
Anti-GZMH antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV42686
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human GZMH with an internal ID of P24919
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMA
FVQFLQEKSRKRCGG
Storage
-20C
Provider Type Product Number
- No reagents -