HPA029200

GZMH antibody from Sigma-Aldrich
CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029200
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA029200, RRID:AB_10602908
Product name
Anti-GZMH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA029200
Antibody type
Polyclonal
Antigen
granzyme H (cathepsin G-like 2, protein h-CCPX) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPS
SKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTV
QKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGD
SGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFL
PWIKRTM
Storage
-20C
Provider Type Product Number
- No reagents -