Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079718-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079718-M01, RRID:AB_490081
- Product name
- TBL1XR1 monoclonal antibody (M01), clone 3G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TBL1XR1.
- Antigen sequence
LSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAA
AAASQQGSAKNGENTANGEENGAHTIANNHTDMME
VDGDVEIPPNKAVVLRGHESEVFICAWN- Isotype
- IgG
- Antibody clone number
- 3G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The repressing function of the oncoprotein BCL-3 requires CtBP, while its polyubiquitination and degradation involve the E3 ligase TBLR1.
Keutgens A, Shostak K, Close P, Zhang X, Hennuy B, Aussems M, Chapelle JP, Viatour P, Gothot A, Fillet M, Chariot A
Molecular and cellular biology 2010 Aug;30(16):4006-21
Molecular and cellular biology 2010 Aug;30(16):4006-21
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TBL1XR1 monoclonal antibody (M01), clone 3G7 Western Blot analysis of TBL1XR1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TBL1XR1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TBL1XR1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TBL1XR1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
