Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004174 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004174, RRID:AB_1079744
- Product name
- Anti-RARB
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLT
QTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPR
VYKPCFVCQDKSSGYHYGV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Profound gene expression changes in the epithelial monolayer of active ulcerative colitis and Crohn’s disease
Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma
Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma
Xue X, Sæterstad S, Østvik A, Røyset E, Bakke I, Sandvik A, Granlund A
PLOS ONE 2022;17(3):e0265189
PLOS ONE 2022;17(3):e0265189
Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma
Seidensaal K, Nollert A, Feige A, Muller M, Fleming T, Gunkel N, Zaoui K, Grabe N, Weichert W, Weber K, Plinkert P, Simon C, Hess J
Molecular Cancer 2015;14(1)
Molecular Cancer 2015;14(1)
Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma
Seidensaal K, Nollert A, Feige A, Muller M, Fleming T, Gunkel N, Zaoui K, Grabe N, Weichert W, Weber K, Plinkert P, Simon C, Hess J
Molecular Cancer 2015 December;14(1)
Molecular Cancer 2015 December;14(1)
No comments: Submit comment
No validations: Submit validation data