Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R31576 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- RUNX1 Antibody (AML1)
- Antibody type
- Polyclonal
- Antigen
- An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human, mouse and rat).
- Description
- Antigen affinity purified antibody
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the RUNX1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of RUNX1 antibody and recombinant human protein (0.5ng)
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC-P: RUNX1 antibody testing of human breast cancer tissue
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC-P: RUNX1 antibody testing of rat thymus tissue
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC-P: RUNX1 antibody testing of mouse intestine tissue