Antibody data

Product number
AMAb91268
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#AMAb91268, RRID:AB_2665875
Product name
Anti-ADGRL4
Provider product page
Atlas Antibodies - AMAb91268
Antibody type
Monoclonal
Reactivity
Human
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGT
VCIENVNANCHLDNVCIAANINKTLTKIRSIKEPV
ALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGY
KNNTIS
Epitope
Binds to an epitope located within the peptide sequence CVPGFRSSSN as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL4164
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -