Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007431-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007431-M01, RRID:AB_535093
- Product name
- VIM monoclonal antibody (M01), clone 3E9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant VIM.
- Antigen sequence
GSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVP
GVRLLQDSVDFSLADAINTEFKNTRTNEKVELQEL
NDRFANYIDKVRFLEQQNKILLAELEQLKG- Isotype
- IgG
- Antibody clone number
- 3E9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- VIM monoclonal antibody (M01), clone 3E9 Western Blot analysis of VIM expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of VIM expression in transfected 293T cell line by VIM monoclonal antibody (M01), clone 3E9.Lane 1: VIM transfected lysate(53.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to VIM on HeLa cell. [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- A-549 cells were stained with VIM-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
- Validation comment
- Immunofluorescence (Circulating Tumor Cell)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of VIM transfected lysate using anti-VIM monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VIM MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
