HPA001677

antibody from Atlas Antibodies

Targeting: GOLIM4 GIMPC, GOLPH4, GPP130, P138

Antibody data

Submit

Validation data

Product number: HPA001677 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001677, RRID:AB_1079017
Product name: Anti-GOLIM4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHA RAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEA QQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMA LQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGA ED
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GOLIM4 protein structure - HPA001677 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and skin tissues using Anti-GOLIM4 antibody. Corresponding GOLIM4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, skin and small intestine using Anti-GOLIM4 antibody HPA001677 (A) shows similar protein distribution across tissues to independent antibody HPA002315 (B).
Antibody #2 product nr: HPA002315
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-GOLIM4 antibody HPA001677.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-GOLIM4 antibody HPA001677.
Sample type: HUMAN