HPA023882

antibody from Atlas Antibodies

Targeting: FAT1 CDHF7, CDHR8, FAT

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

HPA023882

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA023882, RRID:AB_1848429

Product name

Anti-FAT1

Antibody type

Polyclonal

Reactivity

Human

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLL
FVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRIL
NVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTAR
LSFVTPRHHRAAVCLCKEGRCP


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Submitted references

Genomic and molecular characterization of esophageal squamous cell carcinoma.

Lin DC, Hao JJ, Nagata Y, Xu L, Shang L, Meng X, Sato Y, Okuno Y, Varela AM, Ding LW, Garg M, Liu LZ, Yang H, Yin D, Shi ZZ, Jiang YY, Gu WY, Gong T, Zhang Y, Xu X, Kalid O, Shacham S, Ogawa S, Wang MR, Koeffler HP
Nature genetics 2014 May;46(5):467-73

---

A Soluble Form of the Giant Cadherin Fat1 Is Released from Pancreatic Cancer Cells by ADAM10 Mediated Ectodomain Shedding

Wojtalewicz N, Sadeqzadeh E, Weiß J, Tehrani M, Klein-Scory S, Hahn S, Schmiegel W, Warnken U, Schnölzer M, de Bock C, Thorne R, Schwarte-Waldhoff I, Hoffmann A
PLoS ONE 2014 March;9(3)

---

The genomic landscape of nasopharyngeal carcinoma

Lin D, Meng X, Hazawa M, Nagata Y, Varela A, Xu L, Sato Y, Liu L, Ding L, Sharma A, Goh B, Lee S, Petersson B, Yu F, Macary P, Oo M, Ha C, Yang H, Ogawa S, Loh K, Koeffler H
Nature Genetics 2014 June;46(8):866-871

---

Quantitative temporal viromics: an approach to investigate host-pathogen interaction.

Weekes MP, Tomasec P, Huttlin EL, Fielding CA, Nusinow D, Stanton RJ, Wang ECY, Aicheler R, Murrell I, Wilkinson GWG, Lehner PJ, Gygi SP
Cell 2014 Jun 5;157(6):1460-1472

---

Recurrent somatic mutation of FAT1 in multiple human cancers leads to aberrant Wnt activation.

Morris LG, Kaufman AM, Gong Y, Ramaswami D, Walsh LA, Turcan Ş, Eng S, Kannan K, Zou Y, Peng L, Banuchi VE, Paty P, Zeng Z, Vakiani E, Solit D, Singh B, Ganly I, Liau L, Cloughesy TC, Mischel PS, Mellinghoff IK, Chan TA
Nature genetics 2013 Mar;45(3):253-61

---

Deregulation of the Protocadherin Gene FAT1 Alters Muscle Shapes: Implications for the Pathogenesis of Facioscapulohumeral Dystrophy

Caruso N, Herberth B, Bartoli M, Puppo F, Dumonceaux J, Zimmermann A, Denadai S, Lebossé M, Roche S, Geng L, Magdinier F, Attarian S, Bernard R, Maina F, Levy N, Helmbacher F, Cox G
PLoS Genetics 2013 June;9(6)

Immunohistochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human rectum shows strong membranous positivity in glandular cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in smooth muscle cells and glandular cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Sample type

HUMAN