PAB20114

CCDC80 antibody from Abnova Corporation
CL2, DRO1, LINC01279, SSG1, TCONS_00006930, URB

Antibody data

Product number
PAB20114
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20114, RRID:AB_10962639
Product name
CCDC80 polyclonal antibody
Provider product page
Abnova Corporation - PAB20114
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CCDC80.
Antigen sequence
MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVR
RITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMV
LLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEK
IRQKGFVQKCKASGVEGQVVAEGNDGGG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.