HPA002266

CCDC80 antibody from Atlas Antibodies
CL2, DRO1, LINC01279, SSG1, TCONS_00006930, URB

Antibody data

Product number
HPA002266
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002266, RRID:AB_1078423
Product name
Anti-CCDC80
Provider product page
Atlas Antibodies - HPA002266
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVR
RITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMV
LLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEK
IRQKGFVQKCKASGVEGQVVAEGNDGGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.