Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109577 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 336 (ZNF336) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF336 antibody: synthetic peptide directed towards the N terminal of human ZNF336
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
LCDVTVSVEYQGVRKDFMAHKAVLAATSKFFKEVF
LNEKSVDGTRTNVYL- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Identification of a novel glial cell line-derived neurotrophic factor-inducible gene required for renal branching morphogenesis.
Fukuda N, Ichihara M, Morinaga T, Kawai K, Hayashi H, Murakumo Y, Matsuo S, Takahashi M
The Journal of biological chemistry 2003 Dec 12;278(50):50386-92
The Journal of biological chemistry 2003 Dec 12;278(50):50386-92
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-ZNF336 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate; ZNF336 antibody - N-terminal region (AP42191PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Heart; ZNF336 antibody - N-terminal region (AP42191PU-N) in Human Heart cells using Immunohistochemistry