Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000081-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000081-M01, RRID:AB_605899
- Product name
- ACTN4 monoclonal antibody (M01), clone 4D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACTN4.
- Antigen sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKV
QQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVV
GPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERS
IVDYK- Isotype
- IgG
- Antibody clone number
- 4D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ACTN4 copy number increase as a predictive biomarker for chemoradiotherapy of locally advanced pancreatic cancer.
RNAi-mediated down-regulation of alpha-actinin-4 decreases invasion potential in oral squamous cell carcinoma.
Watanabe T, Ueno H, Watabe Y, Hiraoka N, Morizane C, Itami J, Okusaka T, Miura N, Kakizaki T, Kakuya T, Kamita M, Tsuchida A, Nagakawa Y, Wilber H, Yamada T, Honda K
British journal of cancer 2015 Feb 17;112(4):704-13
British journal of cancer 2015 Feb 17;112(4):704-13
RNAi-mediated down-regulation of alpha-actinin-4 decreases invasion potential in oral squamous cell carcinoma.
Yamada S, Yanamoto S, Yoshida H, Yoshitomi I, Kawasaki G, Mizuno A, Nemoto TK
International journal of oral and maxillofacial surgery 2010 Jan;39(1):61-7
International journal of oral and maxillofacial surgery 2010 Jan;39(1):61-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ACTN4 monoclonal antibody (M01), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01), clone 4D10.Lane 1: ACTN4 transfected lysate(104.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ACTN4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human lung adenocarcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol