Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001874 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001874, RRID:AB_1079522
- Product name
- Anti-ODF2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSE
KLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMN
AVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAH
ELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQ
EKE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Subunit composition of the human cytoplasmic dynein-2 complex.
A role for the Golgi matrix protein giantin in ciliogenesis through control of the localization of dynein-2.
Hook2 is involved in the morphogenesis of the primary cilium
Asante D, Stevenson NL, Stephens DJ
Journal of cell science 2014 Nov 1;127(Pt 21):4774-87
Journal of cell science 2014 Nov 1;127(Pt 21):4774-87
A role for the Golgi matrix protein giantin in ciliogenesis through control of the localization of dynein-2.
Asante D, Maccarthy-Morrogh L, Townley AK, Weiss MA, Katayama K, Palmer KJ, Suzuki H, Westlake CJ, Stephens DJ
Journal of cell science 2013 Nov 15;126(Pt 22):5189-97
Journal of cell science 2013 Nov 15;126(Pt 22):5189-97
Hook2 is involved in the morphogenesis of the primary cilium
Baron Gaillard C, Pallesi-Pocachard E, Massey-Harroche D, Richard F, Arsanto J, Chauvin J, Lecine P, Kramer H, Borg J, Le Bivic A
Molecular Biology of the Cell 2011 November;22(23):4549-4562
Molecular Biology of the Cell 2011 November;22(23):4549-4562
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and prostate tissues using Anti-ODF2 antibody. Corresponding ODF2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows low expression as expected.
- Sample type
- HUMAN
