HPA023918

antibody from Atlas Antibodies

Targeting: STC1 STC

Antibody data

Submit

Validation data

Product number: HPA023918 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA023918, RRID:AB_1857566
Product name: Anti-STC1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGA FACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAF VKESL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

STC1 protein structure - HPA023918 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using HPA023918 antibody. Corresponding STC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Sample type: HUMAN