Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009735-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009735-M01, RRID:AB_464411
- Product name
- KNTC1 monoclonal antibody (M01), clone 10H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KNTC1.
- Antigen sequence
DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIIN
KKEFGILAKTKYFQMLKMHAMNTNNITELVNYLAN
DLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMF
LSGLS- Isotype
- IgG
- Antibody clone number
- 10H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mitotic control of kinetochore-associated dynein and spindle orientation by human Spindly.
Modulations of cell cycle checkpoints during HCV associated disease.
Chan YW, Fava LL, Uldschmid A, Schmitz MH, Gerlich DW, Nigg EA, Santamaria A
The Journal of cell biology 2009 Jun 1;185(5):859-74
The Journal of cell biology 2009 Jun 1;185(5):859-74
Modulations of cell cycle checkpoints during HCV associated disease.
Sarfraz S, Hamid S, Ali S, Jafri W, Siddiqui AA
BMC infectious diseases 2009 Aug 10;9:125
BMC infectious diseases 2009 Aug 10;9:125
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- KNTC1 monoclonal antibody (M01), clone 10H4 Western Blot analysis of KNTC1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KNTC1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to KNTC1 on HeLa cell. [antibody concentration 50 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol