Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002188 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002188, RRID:AB_1078822
- Product name
- Anti-FABP4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMA
KPNMIISVNGDVITIKSESTFKNTEISFILGQEFD
EVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKR
KREDDKLVVECVMKGVTSTRVYE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Profiling of Atherosclerotic Lesions by Gene and Tissue Microarrays Reveals PCSK6 as a Novel Protease in Unstable Carotid Atherosclerosis
Identification of new genes involved in human adipogenesis and fat storage.
Differential Expression of Lipid Metabolism Related Genes in Porcine Muscle Tissue Leading to Different Intramuscular Fat Deposition
Perisic L, Hedin E, Razuvaev A, Lengquist M, Osterholm C, Folkersen L, Gillgren P, Paulsson-Berne G, Ponten F, Odeberg J, Hedin U
Arteriosclerosis, Thrombosis, and Vascular Biology 2013 September;33(10):2432-2443
Arteriosclerosis, Thrombosis, and Vascular Biology 2013 September;33(10):2432-2443
Identification of new genes involved in human adipogenesis and fat storage.
Söhle J, Machuy N, Smailbegovic E, Holtzmann U, Grönniger E, Wenck H, Stäb F, Winnefeld M
PloS one 2012;7(2):e31193
PloS one 2012;7(2):e31193
Differential Expression of Lipid Metabolism Related Genes in Porcine Muscle Tissue Leading to Different Intramuscular Fat Deposition
Zhao S, Ren L, Chen L, Zhang X, Cheng M, Li W, Zhang Y, Gao S
Lipids 2009 November;44(11):1029-1037
Lipids 2009 November;44(11):1029-1037
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human adipose tissue and cerebral cortex tissues using HPA002188 antibody. Corresponding FABP4 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adipose tissue shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in endothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adipose tissue shows strong cytoplasmic positivity in adipocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.
- Sample type
- HUMAN