Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002196 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002196, RRID:AB_1079107
- Product name
- Anti-IGFBP7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVL
IWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEK
HEVTGWVLVSPLSKEDAGEYECHASNSQGQA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Low levels of IGFBP7 expression in high-grade serous ovarian carcinoma is associated with patient outcome.
Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
Pilot study identifying myosin heavy chain 7, desmin, insulin-like growth factor 7, and annexin A2 as circulating biomarkers of human heart failure.
Gambaro K, Quinn MC, Cáceres-Gorriti KY, Shapiro RS, Provencher D, Rahimi K, Mes-Masson AM, Tonin PN
BMC cancer 2015 Mar 17;15:135
BMC cancer 2015 Mar 17;15:135
Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
Calon A, Lonardo E, Berenguer-Llergo A, Espinet E, Hernando-Momblona X, Iglesias M, Sevillano M, Palomo-Ponce S, Tauriello D, Byrom D, Cortina C, Morral C, Barceló C, Tosi S, Riera A, Attolini C, Rossell D, Sancho E, Batlle E
Nature Genetics 2015 February;47(4):320-329
Nature Genetics 2015 February;47(4):320-329
Pilot study identifying myosin heavy chain 7, desmin, insulin-like growth factor 7, and annexin A2 as circulating biomarkers of human heart failure.
Chugh S, Ouzounian M, Lu Z, Mohamed S, Li W, Bousette N, Liu PP, Gramolini AO
Proteomics 2013 Aug;13(15):2324-34
Proteomics 2013 Aug;13(15):2324-34
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN