HPA064711

MAP2K7 antibody from Atlas Antibodies
Jnkk2, MKK7, PRKMK7

Antibody data

Product number
HPA064711
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA064711, RRID:AB_2685331
Product name
Anti-MAP2K7
Provider product page
Atlas Antibodies - HPA064711
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYL
TIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRK
TGHVIAVK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -