HPA025926

antibody from Atlas Antibodies

Targeting: NMU

Antibody data

Submit

Validation data

Product number: HPA025926 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA025926, RRID:AB_1854539
Product name: Anti-NMU
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQAS NALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSK TQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVD EEFQSPFASQSRGYFLFRPRNGRRSAGFI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NMU protein structure - HPA025926 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows cytoplasmic positivity in squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong positivity in the peripheral nerve fibers in muscularis externa.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in a subset of cells in the peripheral ganglion.
Sample type: HUMAN