HPA001903

ALX4 antibody from Atlas Antibodies
FPP, KIAA1788, PFM, PFM2

Antibody data

Product number
HPA001903
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001903, RRID:AB_2666495
Product name
Anti-ALX4
Provider product page
Atlas Antibodies - HPA001903
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARY
GAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQP
SPQPQPQQQQPQPQPPAQPHLYLQRGACKTPPDGS
LKLQEGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -