AV33240

ALX4 antibody from Sigma-Aldrich
FPP, KIAA1788, PFM, PFM2
No application information provided.

Antibody data

Product number
AV33240
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV33240, RRID:AB_1844786
Product name
Anti-ALX4 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV33240
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ALX4 with an internal ID of P04277
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRA
FPGGDKFGTTFLSAA
Storage
-20C
Provider Type Product Number
- No reagents -