Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001072-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001072-M04, RRID:AB_626405
- Product name
- CFL1 monoclonal antibody (M04), clone 1A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CFL1.
- Antigen sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKA
VLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT
FAKMLPDKDCRYALYDATYETKESKKEDLVFIFWA
PESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
EGVKDRCTLAEKLGGSAVISLEGKPL- Isotype
- IgG
- Antibody clone number
- 1A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Determination of urine cofilin-1 level in acute kidney injury using a high-throughput localized surface plasmon-coupled fluorescence biosensor.
Proteomic analysis of human epithelial lining fluid by microfluidics-based nanoLC-MS/MS: a feasibility study.
Overexpression of cofilin 1 can predict progression-free survival in patients with epithelial ovarian cancer receiving standard therapy.
Chang YF, Chao CH, Lin LY, Tsai CH, Chou C, Lee YJ
Journal of biomedical optics 2014 Jan;19(1):011004
Journal of biomedical optics 2014 Jan;19(1):011004
Proteomic analysis of human epithelial lining fluid by microfluidics-based nanoLC-MS/MS: a feasibility study.
Franciosi L, Govorukhina N, Fusetti F, Poolman B, Lodewijk ME, Timens W, Postma D, ten Hacken N, Bischoff R
Electrophoresis 2013 Sep;34(18):2683-94
Electrophoresis 2013 Sep;34(18):2683-94
Overexpression of cofilin 1 can predict progression-free survival in patients with epithelial ovarian cancer receiving standard therapy.
Nishimura S, Tsuda H, Kataoka F, Arao T, Nomura H, Chiyoda T, Susumu N, Nishio K, Aoki D
Human pathology 2011 Apr;42(4):516-21
Human pathology 2011 Apr;42(4):516-21
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CFL1 monoclonal antibody (M04), clone 1A1. Western Blot analysis of CFL1 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CFL1 is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
