AV35480

KCNH6 antibody from MilliporeSigma / Merck KGaA
erg2, HERG2, Kv11.2
No application information provided.

Antibody data

Product number
AV35480
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV35480, RRID:AB_1848236
Product name
Anti-KCNH6 (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV35480
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KCNH6 with an internal ID of P06720
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STLYFISRGSIEILRDDVVVAILGKNDIFGEPVSL
HAQPGKSSADVRALT
Storage
-20C
Provider Type Product Number
- No reagents -