HPA044868

antibody from Atlas Antibodies

Targeting: TPP1 CLN2, LPIC, SCAR7, TPP-1

Antibody data

Submit

Validation data

Product number: HPA044868 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA044868, RRID:AB_2679122
Product name: Anti-TPP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQ DVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGG NFAHQASVARVV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TPP1 protein structure - HPA044868 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-TPP1 antibody. Corresponding TPP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, kidney, skeletal muscle and testis using Anti-TPP1 antibody HPA044868 (A) shows similar protein distribution across tissues to independent antibody HPA037709 (B).
Antibody #2 product nr: HPA037709
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows strong granular cytoplasmic positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-TPP1 antibody HPA044868.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-TPP1 antibody HPA044868.
Sample type: HUMAN