HPA041985

NOD2 antibody from Atlas Antibodies
BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, PSORAS1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041985
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041985, RRID:AB_2677780
Product name
Anti-NOD2
Provider product page
Atlas Antibodies - HPA041985
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPH
SLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGF
VSQYECDEIRLPI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -