HPA047744

antibody from Atlas Antibodies

Targeting: NAPSA KAP, Kdap, NAP1, NAPA

Antibody data

Submit

Validation data

Product number: HPA047744 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA047744, RRID:AB_2680143
Product name: Anti-NAPSA
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFG EALWEPSLVF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NAPSA protein structure - HPA047744 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and placenta tissues using Anti-NAPSA antibody. Corresponding NAPSA RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, lung and lymph node using Anti-NAPSA antibody HPA047744 (A) shows similar protein distribution across tissues to independent antibody HPA045280 (B).
Antibody #2 product nr: HPA045280, HPA047236
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-NAPSA antibody HPA047744.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-NAPSA antibody HPA047744.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-NAPSA antibody HPA047744.
Sample type: HUMAN