HPA003539

IL3RA antibody from Atlas Antibodies
CD123
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003539
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003539, RRID:AB_1078438
Product name
Anti-IL3RA
Provider product page
Atlas Antibodies - HPA003539
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYS
MPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWI
LFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPG
APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIG
CRFDDIS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -