Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003039-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003039-M02, RRID:AB_606361
- Product name
- HBA1 monoclonal antibody (M02), clone 4F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HBA1.
- Antigen sequence
MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADAL
TNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLL
SHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVL
TSKYR- Isotype
- IgG
- Antibody clone number
- 4F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The differentiating and apoptotic effects of 2-aza-5'-deoxycytidine are dependent on the PU.1 expression level in PU.1-transgenic K562 cells.
Aoyama S, Nakano H, Danbara M, Higashihara M, Harigae H, Takahashi S
Biochemical and biophysical research communications 2012 Apr 20;420(4):775-81
Biochemical and biophysical research communications 2012 Apr 20;420(4):775-81
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HBA1 monoclonal antibody (M02), clone 4F9. Western Blot analysis of HBA1 expression in human placenta.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HBA1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol